PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sof007970
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Andropogonodae; Andropogoneae; Saccharinae; Saccharum; Saccharum officinarum complex
Family HD-ZIP
Protein Properties Length: 304aa    MW: 32859.3 Da    PI: 9.3066
Description HD-ZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
PUT-157a-Saccharum_officinarum-95677PU_refplantGDBView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox61.11.8e-19191245256
                T--SS--HHHHHHHHHHHHHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHHH CS
   Homeobox   2 rkRttftkeqleeLeelFeknrypsaeereeLAkklgLterqVkvWFqNrRakek 56 
                rk+ +++k+q  +Le+ F+++++++ ++++ LAk+l+L+ rqV vWFqNrRa+ k
  Sof007970 191 RKKLRLSKDQAAVLEDSFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTK 245
                788899***********************************************98 PP

2HD-ZIP_I/II113.11.8e-36191267177
  HD-ZIP_I/II   1 ekkrrlskeqvklLEesFeeeekLeperKvelareLglqprqvavWFqnrRARtktkqlEkdyeaLkraydalkeen 77 
                  +kk+rlsk+q+++LE+sF+e+++L+p++K++la++L+l+prqv+vWFqnrRARtk+kq+E+d+e+Lkr +++l e++
    Sof007970 191 RKKLRLSKDQAAVLEDSFKEHNTLNPKQKAALAKQLNLKPRQVEVWFQNRRARTKLKQTEVDCEFLKRFCKTLPEKT 267
                  69********************************************************************9998765 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046181.9E-2315157IPR006712HD-ZIP protein, N-terminal
Gene3DG3DSA:1.10.10.601.1E-19176241IPR009057Homeodomain-like
SuperFamilySSF466896.84E-19179248IPR009057Homeodomain-like
PROSITE profilePS5007117.184187247IPR001356Homeobox domain
SMARTSM003892.4E-17189251IPR001356Homeobox domain
CDDcd000861.03E-17191248No hitNo description
PfamPF000468.8E-17191245IPR001356Homeobox domain
PROSITE patternPS000270222245IPR017970Homeobox, conserved site
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 304 aa     Download sequence    Send to blast
MEMAVNARDE EQYGKNDNHL GLGLSLSLGI ATAAPVEVEP PPAPPRQQQQ QRAISVEPIS  60
SLLPAPQWWN GPAGLFFSPS SGMMDPSLER KHQHQPQPPS TCHSHEMPFL RLRGIDVNRA  120
PAAGETGRRG SCSEDEEPGA SSPNSTLSSL SGKRAAPARS SGEVDREADH TPRAGGGGSD  180
DEDSGAGGGS RKKLRLSKDQ AAVLEDSFKE HNTLNPKQKA ALAKQLNLKP RQVEVWFQNR  240
RARTKLKQTE VDCEFLKRFC KTLPEKTRGC NGSWGLPXLK LVGADHYGRI GGGTKLNMGP  300
SGRX
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1189195SRKKLRL
2239247RRARTKLKQ
Expression -- UniGene ? help Back to Top
UniGene ID E-value Expressed in
Sof.133640.0bud| callus| crown| stem
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_002467488.11e-135hypothetical protein SORBIDRAFT_01g029000
SwissprotQ406919e-59HOX1_ORYSI; Homeobox-leucine zipper protein HOX1
SwissprotQ7XC549e-59HOX1_ORYSJ; Homeobox-leucine zipper protein HOX1
TrEMBLC5WRJ51e-135C5WRJ5_SORBI; Putative uncharacterized protein Sb01g029000
STRINGSb01g029000.11e-135(Sorghum bicolor)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16780.12e-42homeobox protein 2